PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA013510-PA
Common NameOsI_13400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 803aa    MW: 83534.9 Da    PI: 7.5001
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA013510-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.9e-096096461954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  BGIOSGA013510-PA 609 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 646
                       564459******************************88 PP

2BELL89.53.4e-294875401972
              BELL  19 VdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       Vd+rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  BGIOSGA013510-PA 487 VDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQL 540
                       9**************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.5E-33385538IPR006563POX domain
PfamPF075264.1E-39419537IPR006563POX domain
PROSITE profilePS5007112.6587650IPR001356Homeobox domain
SMARTSM003891.6E-9590654IPR001356Homeobox domain
CDDcd000864.70E-13590651No hitNo description
SuperFamilySSF466892.74E-17592657IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28593656IPR009057Homeodomain-like
PfamPF059204.1E-18607646IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 803 aa     Download sequence    Send to blast
MGIAAPPCQP GQTTTFVISQ PTSSKSSPAA IVVRPPATAS SSSMSHSQGF HQPSSGAVFG  60
FSSDGFDGRP GSGQDHQQHE QQQQQHVAQQ SRRDKLRVQG FDPAAAAAGH GLLPIEGDEH  120
GAEPGAMYDH AEAAAAGASN MLSEMFNFPS QPPTGPSATE LLASQMNANY RFGFRQAAGL  180
AGGEGGWFGG GGAAGRTGLV LGGASLGSLG ETSSPKQQAS GMAGLAADPA AAMHLFLMNP  240
QQQQQQSRSS TSPPPSDAQS AIHQHHEAFQ AFGGAGAAAF GGGAAAGVVE GQGLSLSLSP  300
SLQQLEMAKQ AEELRVRDGV LYFNRQQQQQ QAAAAAASVQ QQLPMALALV QWSALLVGTH  360
AARAGVVRLA PSGLSLGVLL QLQCTPRAAQ RAPRRSSAAF GRGQIKGSGG RGSAPNNPNS  420
SKAAAGAASS SGAAQSPSLA SKEPPQLSPA DRFEHQRKKA KLISMLDEAR VIRVASLPGE  480
KVFYMGVDRR YNHYCDQMQM VVNFFDSVMG FGAATPYTAL AQKAMSRHFR CLKDAIAAQL  540
RGTCEALGEK DAGTGSGLTK GETPRLRAID QSLRQQRAFH HMGIMEQEAW RPQRGLPERS  600
VNILRSWLFE HFLHPYPSDA DKHLLARQTG LSRNQVSNWF INARVRLWKP MIEEMYQQEC  660
KELEGSSGAG DDPSGADDTH SPTTTAAAHH QHRHGQLMVE HGGASSGGGA AMSSHKHEPG  720
VVAGPSSSSA AAVADAAFVG IDPVELLGGD GAAADDLYGR FDPAGAAAAA GDVSLTLGLQ  780
HAGAGNAGPD GSGRFSLRDY SGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-17596653158Homeobox protein Meis1
4xrs_B2e-17596653158Homeobox protein Meis1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.983700.0leaf| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567640910.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1035500.0AC103550.13 Oryza sativa chromosome 3 BAC OSJNBa0079G12 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631398.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLA2XLP80.0A2XLP8_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA013510-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-112BEL1-like homeodomain 4